The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of probable rRNA-methyltransferase from Porphyromonas gingivalis. To be Published
    Site NYSGXRC
    PDB Id 3kw2 Target Id NYSGXRC-11285c
    Molecular Characteristics
    Source Porphyromonas gingivalis
    Alias Ids TPS31700,PF04452, 3.40.1280.10, NP_906208.1 Molecular Weight 27796.28 Da.
    Residues 248 Isoelectric Point 5.20
    Sequence mslplfyapdieqsdrlpddeaghilrvlrmqagdrlrltdgrgsffdavietadrkscyvsvcgqepw qkpwrdritiaiaptkqsermewmleklveigvdevvfiesehserrrikaerleriaisamkqslkas fpviqvnipiqtviadtpktavrliayvdeavraeitqgrgypsdfyhvgqdvliligpegdfspseve sallagfapvslgesrlrtetaglvacqwihtlqaccrige
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.266
    Matthews' coefficent 2.10 Rfactor 0.210
    Waters 136 Solvent Content 41.30

    Ligand Information
    Ligands ADN (ADENOSINE) x 2


    Google Scholar output for 3kw2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch