.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kts

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF GLYCEROL UPTAKE OPERON ANTITERMINATOR REGULATORY PROTEIN FROM LISTERIA MONOCYTOGENES STR. 4b F2365. To be Published
    Site NYSGXRC
    PDB Id 3kts Target Id NYSGXRC-13910a
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS31562,AAT04199.1, PF04309 Molecular Weight 20039.47 Da.
    Residues 182 Isoelectric Point 6.65
    Sequence lelpfsnqsiipaahnqkdmekileldltymvmlethvaqlkalvkyaqaggkkvllhadlvnglkndd yaidflcteicpdgiistrgnaimkakqhkmlaiqrlfmidssaynkgvaliqkvqpdciellpgiipe qvqkmtqklhipviagglietseqvnqviasgaiavttsnkhlw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.75 Rfree 0.27150
    Matthews' coefficent 2.64 Rfactor 0.21786
    Waters 2 Solvent Content 53.41

    Ligand Information
    Ligands UNL (UNKNOWN) x 8
    Metals

    Jmol

     
    Google Scholar output for 3kts

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch