The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of response regulator receiver protein from Pseudoalteromonas atlantica. To be Published
    Site NYSGXRC
    PDB Id 3kto Target Id NYSGXRC-11026h
    Molecular Characteristics
    Source Pseudoalteromonas atlantica
    Alias Ids TPS31616,, Q15U25_PSEA6, PF00072 Molecular Weight 14948.48 Da.
    Residues 135 Isoelectric Point 6.02
    Sequence mistlvtknhhpiiylvdhqkdaraalskllspldvtiqcfasaesfmrqqisddaigmiieahledkk dsgielletlvkrgfhlptivmasssdiptavramrasaadfiekpfiehvlvhdvqqiingakph
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.98 Rfree 0.243
    Matthews' coefficent 2.39 Rfactor 0.218
    Waters 279 Solvent Content 48.44

    Ligand Information


    Google Scholar output for 3kto

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch