.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ksu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Short-Chain Dehydrogenase from Oenococcus Oeni Psu-1. To be Published
    Site NYSGXRC
    PDB Id 3ksu Target Id NYSGXRC-11163m
    Molecular Characteristics
    Source Oenococcus oeni
    Alias Ids TPS31637,3.40.50.720, YP_809745.1 Molecular Weight 27840.20 Da.
    Residues 252 Isoelectric Point 6.39
    Sequence mtkyhdlknkviviaggiknlgaltaktfalesvnlvlhyhqakdsdtanklkdeledqgakvalyqsd lsneeevaklfdfaekefgkvdiaintvgkvlkkpivetseaefdamdtinnkvayffikqaakhmnpn ghiitiatsllaaytgfystyagnkapvehytraaskelmkqqisvnaiapgpmdtsffygqetkesta fhksqamgnqltkiediapiikflttdgwwingqtifanggyttr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.286
    Matthews' coefficent 2.23 Rfactor 0.230
    Waters 86 Solvent Content 44.77

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ksu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch