The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a glyoxalase/dioxygenase from Nostoc punctiforme. To be Published
    Site NYSGXRC
    PDB Id 3kol Target Id NYSGXRC-11005o
    Molecular Characteristics
    Source Nostoc punctiforme
    Alias Ids TPS31609,ZP_00109964, PF00903, Molecular Weight 16998.25 Da.
    Residues 155 Isoelectric Point 4.73
    Sequence mlsstqsvnsvlapgnlrkvhhialnvqdmqasryfygtilglheltddevpatltelvasgkvanfit pdgtildlfgepelsppdpnpektftrayhlafdidpqlfdravtvigenkiaiahgpvtrptgrgvyf ydpdgfmieircdpeas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.234
    Matthews' coefficent 2.55 Rfactor 0.213
    Waters 100 Solvent Content 51.79

    Ligand Information
    Metals CO (COBALT) x 2


    Google Scholar output for 3kol

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch