.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kl2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative isochorismatase from Streptomyces avermitilis. To be Published
    Site NYSGXRC
    PDB Id 3kl2 Target Id NYSGXRC-11302e
    Molecular Characteristics
    Source Streptomyces avermitilis
    Alias Ids TPS31702,PF00857, NP_822563.1, 3.40.50.850 Molecular Weight 25050.19 Da.
    Residues 235 Isoelectric Point 5.87
    Sequence lsvcqtrsyrgsrcasghkattsktrksgvamtekleldpartaivlieyqneftsdggvlhgavadvm qhtgmlantvavvdaarqagvpimhapitfaegygeltrhpygilkgvvdgkafvkgtwgaaivdelap vngdiviegkrgldtfastnldfilrskgvdtivlggfltnccvestmrtgyergfrvitltdcvaats qeehnnaisydfpmfsvpmtsadviaal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.30 Rfree 0.239
    Matthews' coefficent 2.30 Rfactor 0.188
    Waters 174 Solvent Content 46.54

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3kl2
    1. Mcl_1Bim complexes accommodate surprising point mutations via minor structural changes
    E Fire, SV Gull, RA Grant, AE Keating - Protein Science, 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch