The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a LacI family transcriptional regulator from Mycobacterium smegmatis. To be Published
    Site NYSGXRC
    PDB Id 3kke Target Id NYSGXRC-11029c
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS31618,A0QPR6_MYCSM,, PF00532 Molecular Weight 35725.32 Da.
    Residues 342 Isoelectric Point 5.59
    Sequence vgtladvaraagvsvsiasralsgdtrarmseatrarvlaaadelnyvpnararalrhsrsgtiglivp dvnnavfadmfsgvqmaasghstdvllgqidapprgtqqlsrlvsegrvdgvllqrredfdddmlaavl egvpavtinsrvpgrvgsvilddqkgggiatehlitlghsriafisgtaihdtaqrrkegyletlasag lrseaawvvdagweadagsaalntlyrganlgkpdgptavvvasvnaavgalstalrlglrvpedlsiv ginttwvsdtvypalttvrlplqrlgevaadvlmehlggraltdtvvtqptpellvrettapptrd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.247
    Matthews' coefficent 1.92 Rfactor 0.194
    Waters 127 Solvent Content 35.79

    Ligand Information
    Ligands ACT (ACETATE) x 5


    Google Scholar output for 3kke

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch