.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kjx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a transcriptional regulator, Lacl family protein from Silicibacter pomeroyi. To be Published
    Site NYSGXRC
    PDB Id 3kjx Target Id NYSGXRC-11232m
    Molecular Characteristics
    Source Silicibacter pomeroyi
    Alias Ids TPS31677,3.40.50.2300, PF00532, YP_168878.1 Molecular Weight 37363.95 Da.
    Residues 341 Isoelectric Point 5.45
    Sequence ltadtkrpltlrdvseasgvsemtvsrvlrnrgdvsdatrarvlaaakelgyvpnkiagalasnrvnlv aviipslsnmvfpevltginqvledtelqpvvgvtdylpekeekvlyemlswrpsgviiaglehseaar amldaagipvveimdsdgkpvdamvgishrragremaqailkagyrrigfmgtkmpldyrarkrfegft evlgkngveiedrefysggsalakgremtqamlerspdldflyysndmiaaggllylleqgidipgqig lagfnnvellqglprklatmdacrleigrkaaeiiakrledpeaeietritlepkisygdtlkrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.33 Rfree 0.287
    Matthews' coefficent 2.38 Rfactor 0.238
    Waters 124 Solvent Content 48.42

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3kjx

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch