.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kd6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Nucleoside Kinase from Chlorobium tepidum in Complex with AMP. To be Published
    Site NYSGXRC
    PDB Id 3kd6 Target Id NYSGXRC-11206f
    Molecular Characteristics
    Source Chlorobium tepidum
    Alias Ids TPS31657,AAM72211.1, PF00294, 3.40.1190.20 Molecular Weight 34006.60 Da.
    Residues 304 Isoelectric Point 4.71
    Sequence msllvigslafddietpfgrsdntlggsstyialsasyftdepirmvgvvgsdfgkehfdllhaknidt rgiqviedgktfrwagryhydmntrdtldtqlnvfaefdphvpqyyrdskfvclgnidpelqlkvldqi ddpklvvcdtmnfwiegkpeelkkvlarvdvfivndsearllsgdpnlvktariiremgpktliikkge hgallftdngifaapafplesiydptgagdtfaggfighlarcgntseaemrkavlygsamasfcveqf gpyryndldllevddryqsflelsried
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.88 Rfree 0.237
    Matthews' coefficent 2.25 Rfactor 0.212
    Waters 266 Solvent Content 45.43

    Ligand Information
    Ligands AMP (ADENOSINE) x 2;GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3kd6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch