.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kcn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of adenylate cyclase from Rhodopirellula baltica. To be Published
    Site NYSGXRC
    PDB Id 3kcn Target Id NYSGXRC-11020n
    Molecular Characteristics
    Source Rhodopirellula baltica
    Alias Ids TPS31614,3.40.50.2300, Q7UJS6_RHOBA, PF00072 Molecular Weight 42267.20 Da.
    Residues 382 Isoelectric Point 4.80
    Sequence lgrhmnerillvdddysllntlkrnlsfdfevttcesgpealacikksdpfsvimvdmrmpgmegtevi qkarlispnsvylmltgnqdlttameavnegqvfrflnkpcqmsdikaainagikqydlvtskeellkk tfagaisvlveiieyvddplvntddilksteallveskiasdwripltarlmvagipllnldqretlak aaitsdehrsivkevfsissqlikqiprlepvaelldrmgttevtnakctndddkiaqvillsyyqsll qrrgeagdvafseiedrfpdldnqltehvrqtndaqpqstiesiatselltgmtvaedvrmanglllia sgrklsppmvtrlrnlvglesvaveipakksdqlvta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.45 Rfree 0.2668
    Matthews' coefficent 2.14 Rfactor 0.2173
    Waters 126 Solvent Content 42.65

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3kcn

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch