The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF Uncharacterized Tim-Barrel Protein Bb4693 From Bordetella Bronchiseptica. To be Published
    Site NYSGXRC
    PDB Id 3k4w Target Id NYSGXRC-10053j
    Related PDB Ids 3irs 
    Molecular Characteristics
    Source Bordetella bronchiseptica
    Alias Ids TPS31709,PF04909, Q7WEE2 Molecular Weight 31467.48 Da.
    Residues 281 Isoelectric Point 5.40
    Sequence mkiidfrlrppamgflnariytrpdirnrftrqlgfepapsaeekslelmfeemaaagieqgvcvgrns svlgsvsnadvaavakaypdkfhpvgsieaatrkeamaqmqeildlgirivnlepgvwatpmhvddrrl yplyafcedngipvimmtggnagpditytnpehidrvlgdfpdltvvsshgnwpwvqeiihvafrrpnl ylspdmylynlpghadfiqaansfladrmlfgtaypmcplkeytewfltlpikpdamekilhgnaerll aqagr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 1.92 Rfree 0.251
    Matthews' coefficent 2.36 Rfactor 0.191
    Waters 1903 Solvent Content 47.79

    Ligand Information


    Google Scholar output for 3k4w

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch