The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF putative binding component of ABC transporter from Wolinella succinogenes DSM 1740 complexed with lysine. To be Published
    Site NYSGXRC
    PDB Id 3k4u Target Id NYSGXRC-11316q
    Molecular Characteristics
    Source Wolinella succinogenes
    Alias Ids TPS31706,, PF00497, CAE09431.1 Molecular Weight 30358.93 Da.
    Residues 267 Isoelectric Point 7.70
    Sequence mkkiwlgilisvctllgadmslwqkstlneiikrgelrvglepgylpfemkdkkgnvigfdvdlarema kamgvklklvptswdglipglvtekfdiiisgmtisqernlrvnfvepyivvgqsllvkkglekgvksy kdldkpeltlvtkfgvsaeyaakrlfknaklktydteaeavqevlngkadmfifdlpfnvafmaqkgqg ylvhldtsltyeplgwaikkgdpdflnwlnhflaqikhdgsydelyerwfvdtkwlekiq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.62 Rfree 0.266
    Matthews' coefficent 2.79 Rfactor 0.202
    Waters 116 Solvent Content 55.95

    Ligand Information
    Ligands LYS x 6


    Google Scholar output for 3k4u

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch