.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k4h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF putative transcriptional regulator LacI from Bacillus cereus subsp. cytotoxis NVH 391-98. To be Published
    Site NYSGXRC
    PDB Id 3k4h Target Id NYSGXRC-11007j
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS31613,3.40.50.2300, PF00532, NP_833729 Molecular Weight 37619.19 Da.
    Residues 342 Isoelectric Point 7.02
    Sequence mtvtikdvakkanvapstvsrviadnpsisektkrrvrkvmselgyhpnlnarslanqttktiglvmps sankafqnpffpevirgissfahvegyalymstgeteeeifngvikmvqgrqiggiillysrendriiq ylneknfpfvligkpydkkdkityvdndnytaarevaeyfislghkriafigggsdllvtkdrlagmsd alkladiqlpseyifhldfsresgqqaveelmglkepptaimatddliglgvlsaltakgisvpkdvsl vsfnnvllseiaspplttvdvniyqlgyeaakalvdkvehsessskciviphkllkrqtcegceks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.24388
    Matthews' coefficent 3.48 Rfactor 0.20297
    Waters 24 Solvent Content 64.63

    Ligand Information
    Ligands MAL (MALTOSE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3k4h

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch