.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jyg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized protein WS1659 from Wolinella succinogenes. To be published
    Site NYSGXRC
    PDB Id 3jyg Target Id NYSGXRC-11280b
    Molecular Characteristics
    Source Wolinella succinogenes
    Alias Ids TPS31699,3.30.479.10, PF01242, CAE10689.1 Molecular Weight 21081.07 Da.
    Residues 180 Isoelectric Point 5.60
    Sequence miyqiakefdfcyghrvwsqelnpdfsldpclscrhlhghqgkvivhlesrelqrgmvtdfahlnwfkr fidevldhrfiididdplfptllphfadksalvwmeegyarvdferikgesspilelyesfvvvrfvpt sesiaswllellrsriqplgvkvssvefletpksrarvynea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.95 Rfree 0.233
    Matthews' coefficent 2.79 Rfactor 0.192
    Waters 702 Solvent Content 55.93

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 6

    Jmol

     
    Google Scholar output for 3jyg

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch