The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of LacI Transcriptional regulator from Lactobacillus brevis. To be Published
    Site NYSGXRC
    PDB Id 3jy6 Target Id NYSGXRC-11238g
    Molecular Characteristics
    Source Lactobacillus brevis
    Alias Ids TPS31684,, PF00532, YP_794633.1 Molecular Weight 36333.66 Da.
    Residues 328 Isoelectric Point 6.47
    Sequence markanknanikdvaalagvsiatvsrflngnlgrmsaatatkvqeaitklnyvpnsvarqmitqsskl iavivaniddyfstelfkgissilesrgyigvlfdanadierektllraigsrgfdglilqsfsnpqtv qeilhqqmpvvsvdremdacpwpqvvtdnfeaakaattafrqqgyqhvvvltselelsrtrqeryrgil aaaqdvdvlevsessynhsevhqrltqlitqndqktvafalkerwlleffpnliisglidnqtvtatgf adtdfirrmepkltlitqnpflmgassaeimlrqlagekvapekmvipaklq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.97 Rfree 0.261
    Matthews' coefficent 2.01 Rfactor 0.247
    Waters 176 Solvent Content 38.94

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 2
    Metals CL (CHLORIDE) x 1


    Google Scholar output for 3jy6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch