.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ju2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF PROTEIN SMc04130 FROM Sinorhizobium meliloti. To be Published
    Site NYSGXRC
    PDB Id 3ju2 Target Id NYSGXRC-9475d
    Molecular Characteristics
    Source Sinorhizobium meliloti 1021
    Alias Ids TPS31593,15963875, PF01261 Molecular Weight 29305.11 Da.
    Residues 274 Isoelectric Point 5.67
    Sequence mqveglsinlatireqcgfaeavdiclkhgitaiapwrdqvaaiglgeagrivranglkltglcrggff papdasgrekaiddnrravdeaaelgadclvlvagglpggsknidaarrmvvegiaavlpharaagvpl aieplhpmyaadracvntlgqaldicetlgpgvgvaidvyhvwwdpdlanqiaragkmkailahhicdw lvptkdmltdrgmmgdgvidlkgirrrieaagfhgaqeveifsadnwwkrpadeviatcveryrncc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.24638
    Matthews' coefficent 3.16 Rfactor 0.19919
    Waters 192 Solvent Content 61.06

    Ligand Information
    Ligands GOL (GLYCEROL) x 3
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 3ju2

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch