The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative alcohol dehydrogenase (TM_042) from Thermotoga maritima. To be published
    Site NYSGXRC
    PDB Id 3ip1 Target Id NYSGXRC-11127c
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS31625,AAD35497.1, Molecular Weight 43314.65 Da.
    Residues 395 Isoelectric Point 5.83
    Sequence mravrlhakwdprpefklgpkdiegkltwlgskvwrypevrveevpepriekpteiiikvkacgicgsd vhmaqtdeegyilypgltgfpvtlghefsgvvveagpeainrrtnkrfeigepvcaeemlwcghcrpca egfpnhcenlnelgfnvdgafaeyvkvdakyawslrelegvyegdrlflagslveptsvaynavivrgg girpgdnvvilgggpiglaavailkhagaskvilsepsevrrnlakelgadhvidptkenfveavldyt nglgaklfleatgvpqlvwpqieeviwrarginatvaivaradakipltgevfqvrraqivgsqghsgh gtfprvislmasgmdmtkiisktvsmeeipeyikrlqtdkslvkvtmlne
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.09 Rfree 0.248
    Matthews' coefficent 2.41 Rfactor 0.207
    Waters 610 Solvent Content 48.98

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals CL (CHLORIDE) x 4;CD (CADMIUM) x 8


    Google Scholar output for 3ip1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch