.
The Open Protein Structure Annotation Network
PDB Keyword
.

3io1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Aminobenzoyl-glutamate utilization protein from Klebsiella pneumoniae. To be Published
    Site NYSGXRC
    PDB Id 3io1 Target Id NYSGXRC-11203b
    Molecular Characteristics
    Source Klebsiella pneumoniae
    Alias Ids TPS31654,3.30.70.360, ABR76965.1, PF01546 Molecular Weight 46602.99 Da.
    Residues 436 Isoelectric Point 5.55
    Sequence mpqldeylrqlapsmtqwrrdfhlhaesgwlefrtaskvadildglgyqlalgrdvidadsrmglpdee tlaraferareqgaperwlpafeggfagvvatldtgrpgptlafrvdmdaldlneqhddshrphrdhfa scnagmmhacghdghtaiglglahvlkqyaaqlngviklifqpaeegtrgaramvaagvvddvdyftai higtgvpagtvvcggdnfmattkfdvqfsgvaahaggkpedgrnallaaaqaalglhaipphsagasrv nvgvmqagtgrnvvpssallkvetrgeseainqyvferaqhvvagaaamyearyelrmmgaatasapsp awvdylreqaarvpgvqqavdriaapagsedatlmmarvqargglasymifgtelsaghhnekfdfdes vmavavetlarvalnfpwqrgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.260
    Matthews' coefficent 2.48 Rfactor 0.224
    Waters 94 Solvent Content 50.31

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 2;YT3 (YTTRIUM) x 1

    Jmol

     
    Google Scholar output for 3io1
    1. Mutational and structural analysis of LN-carbamoylase: new insights into a peptidase M20/M25/M40 family member.
    S Martnez-Rodrguez, A Garca-Pino - Journal of , 2012 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch