.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ilh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Two component response regulator from Cytophaga hutchinsonii. To be Published
    Site NYSGXRC
    PDB Id 3ilh Target Id NYSGXRC-11237m
    Molecular Characteristics
    Source Cytophaga hutchinsonii
    Alias Ids TPS31683,3.40.50.2300, YP_677968.1, PF00072 Molecular Weight 15367.72 Da.
    Residues 136 Isoelectric Point 5.03
    Sequence madtrkidsvlliddddivnflnttiirmthrveeiqsvtsgnaainklnelyaagrwpsiicidinmp gingwelidlfkqhfqpmknksivcllsssldprdqakaeasdwvdyyvskpltanalnnlynkvln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.59 Rfree 0.288
    Matthews' coefficent 2.79 Rfactor 0.232
    Waters 14 Solvent Content 55.94

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ilh

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch