.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ifr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of xylulose kinase from Rhodospirillum rubrum. To be Published
    Site NYSGXRC
    PDB Id 3ifr Target Id NYSGXRC-11200h
    Molecular Characteristics
    Source Rhodospirillum rubrum
    Alias Ids TPS31649,PF00370, 3.30.420.40, YP_426355.1 Molecular Weight 52671.79 Da.
    Residues 501 Isoelectric Point 5.34
    Sequence msaaqgrqvigldigttstiailvrlpdtvvavasrpttlssphpgwaeedpaqwwdnaravlaelktt agesdwrpggicvtgmlpavvllddrgavlrpsiqqsdgrcgdevaelraevdseaflartgngvtqql vtaklrwierhepavfgaiatvcgsydyinmlltgervvdrnwaleggfidlasgtveadlvalahipp savppahpthrvlgavtaeaaaltglptglpvyggaadhiasalaagitrpgdvllkfggagdiivasa taksdprlyldyhlvpglyapngcmaatgsalnwlakllapeageaahaqldalaaevpagadglvclp yflgektpihdpfasgtftglslshtrghlwralleavalafrhhvavlddighapqrffasdggtrsr vwmgimadvlqrpvqllanplgsavgaawvaaigggddlgwddvtalvrtgekitpdpakaevydrlyr dfsalyatlhpffhrsrp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.2597
    Matthews' coefficent 2.46 Rfactor 0.2061
    Waters 339 Solvent Content 50.02

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3ifr

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch