.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ibm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF cupin 2 domain-containing PROTEIN Hhal_0468 FROM Halorhodospira halophila. To be Published
    Site NYSGXRC
    PDB Id 3ibm Target Id NYSGXRC-9494c
    Molecular Characteristics
    Source Halorhodospira halophila sl1
    Alias Ids TPS31597,PF07883, 121997271 Molecular Weight 17735.72 Da.
    Residues 157 Isoelectric Point 5.44
    Sequence mssgeheasrvlrerdyrwegteeeaykaegthfsgarrqtlvgrpagqeapafetryfevepggyttl erhehthvvivvrghaevvlddrvepltpldcvyiaphawhqihatganeplgflcivdsdrdrpqrpd addlarlcadpavarrirt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.25767
    Matthews' coefficent 1.93 Rfactor 0.19833
    Waters 166 Solvent Content 36.34

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals K (POTASSIUM) x 2;ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 3ibm
    1. Structural adaptation of extreme halophilic proteins through decrease of conserved hydrophobic contact surface
    A Siglioccolo, A Paiardini, M Piscitelli - BMC Structural , 2011 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch