The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of thio-disulfide isomerase from Thermus thermophilus. To be Published
    Site NYSGXRC
    PDB Id 3ia1 Target Id NYSGXRC-11216b
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS31675,PF08534,, YP_005791.1 Molecular Weight 17721.84 Da.
    Residues 161 Isoelectric Point 7.78
    Sequence mtklwtllvagalslalavkpgeplpdfllldpkgqpvtpatmskpavivfwaswctvckaefpglhrv aeetgvpfyvisreprdtrevvleymkayprfipllasdrdrphevaarfkvlgqpwtfvvdregkvva lfagragrealldalllagadlp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.76 Rfree 0.20398
    Matthews' coefficent 2.58 Rfactor 0.16289
    Waters 335 Solvent Content 52.38

    Ligand Information
    Ligands ACT (ACETATE) x 2


    Google Scholar output for 3ia1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch