The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a mutT/nudix family protein from Listeria innocua. To be Published
    Site NYSGXRC
    PDB Id 3i9x Target Id NYSGXRC-11177n
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS31641,, CAC95722.1 Molecular Weight 27127.19 Da.
    Residues 242 Isoelectric Point 4.40
    Sequence mteefvnkedalknynakefrtpdgytsdmilttvkelngkptlhillikrsltnaegkpnmeggkwav pggfvdenesaeqaaereleeetsltdiplipfgvfdkpgrdprgwiisrafyaivppealekraagdd aaeiglfpmtealelplafdhldmlkkafsaiteefllttairdflpetfsaellyqtlegctkpgilp devefmenieylpylekvgdlyrfnadaeagsiyf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.276
    Matthews' coefficent 3.11 Rfactor 0.223
    Waters 25 Solvent Content 60.46

    Ligand Information
    Ligands GOL (GLYCEROL) x 1


    Google Scholar output for 3i9x

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch