.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i83

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 2-dehydropantoate 2-reductase from Methylococcus capsulatus. To be Published
    Site NYSGXRC
    PDB Id 3i83 Target Id NYSGXRC-11146p
    Molecular Characteristics
    Source Methylococcus capsulatus
    Alias Ids TPS31634,3.40.50.720, YP_114934.1 Molecular Weight 33394.55 Da.
    Residues 312 Isoelectric Point 5.70
    Sequence mnilvigtgaigsfygallaktghcvsvvsrsdyetvkakgirirsatlgdytfrpaavvrsaaeletk pdctllcikvvegadrvgllrdavapdtgivlisngidiepevaaafpdnevisglafigvtrtapgei whqaygrlmlgnypggvservktlaaafeeagidgiatenittarwqkcvwnaafnplsvlsggldtld ilstqegfvraimqeiravaaanghplpediveknvastykmppyktsmlvdfeagqpmetevilgnav ragrrtrvaiphlesvyalmkllelrtskslwgnpp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.227
    Matthews' coefficent 2.19 Rfactor 0.192
    Waters 259 Solvent Content 43.91

    Ligand Information
    Ligands ACY (ACETIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 3i83
    1. Detecting subtle functional differences in ketopantoate reductase and related enzymes using a rule-based approach with sequence-structure homology recognition
    S Mondal, C Nagao, K Mizuguchi - Protein Engineering Design , 2010 - Oxford Univ Press
     
    2. Detection of Spatial Correlations in Protein Structures and Molecular Complexes
    MJ Sippl, M Wiederstein - Structure, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch