The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a periplasmic His/Glu/Gln/Arg/opine family-binding protein from Silicibacter pomeroyi in complex with lysine. To be Published
    Site NYSGXRC
    PDB Id 3i6v Target Id NYSGXRC-11318m
    Molecular Characteristics
    Source Silicibacter pomeroyi
    Alias Ids TPS31708,, PF00497, YP_166549.1 Molecular Weight 28870.58 Da.
    Residues 270 Isoelectric Point 4.31
    Sequence lprrnpsvcraffpsprphnrntndngslsmkklilttaalalsagmamadtvrmgtegayppynfind agevdgferelgdelckragltcewvkndwdsiipnlvsgnydtiiagmsitderdevidftqnyippt assyvatsdgadlsgivaaqtatiqagyiaesgatlvefatpeetiaavrngeadavfadrdylvpiva esggelmfvgddvplgggvgmglresdgelrgkfdaaitsmkedgtlntmikkwfgedaavye
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.224
    Matthews' coefficent 3.57 Rfactor 0.198
    Waters 77 Solvent Content 65.51

    Ligand Information
    Ligands LYS (GLYCEROL) x 1;GOL x 1
    Metals NA (SODIUM) x 1


    Google Scholar output for 3i6v

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch