.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i4k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Muconate lactonizing enzyme from Corynebacterium glutamicum. To be Published
    Site NYSGXRC
    PDB Id 3i4k Target Id NYSGXRC-9450d
    Molecular Characteristics
    Source Corynebacterium glutamicum
    Alias Ids TPS31586,23308936 Molecular Weight 40226.72 Da.
    Residues 373 Isoelectric Point 5.07
    Sequence msdltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpwwggesvetmka lvdgylapvligravselagimadlervvararyakaavdvamhdawarslnvpvrdllggtvrdkvdv twalgvlpldvavaeieerieefgnrsfklkmgagdpaedtrrvaelarevgdrvslridinarwdrrt alhylpilaeagvelfeqptpaddletlreitrrtnvsvmadesvwtpaealavvkaqaadvialkttk hgglleskkiaaiaeagglachgatslegpigtaaslqfaastkaisygtelfgpqllkdtyivqefey kdgqvaipqgpglgvdvdmdkvnfytrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.20 Rfree 0.277
    Matthews' coefficent 2.58 Rfactor 0.244
    Waters 512 Solvent Content 52.32

    Ligand Information
    Ligands ACY (ACETIC) x 8
    Metals MG (MAGNESIUM) x 8

    Jmol

     
    Google Scholar output for 3i4k

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch