.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i4f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative 3-oxoacyl-reductase from bacillus thuringiensis. To be published
    Site NYSGXRC
    PDB Id 3i4f Target Id NYSGXRC-11165i
    Molecular Characteristics
    Source Bacillus thuringiensis
    Alias Ids TPS31639,3.40.50.720, YP_896919.1 Molecular Weight 33077.41 Da.
    Residues 293 Isoelectric Point 6.50
    Sequence lvmclpetlqnfensvlihfscnwcenllhmnysnlkggrfvrhalitagtkglgkqvtekllakgysv tvtyhsditamkkmketyknmeerlqfvqadvtkkedlhkiveeaisrfgkidflinnagpyvferkkl vdyeedewnemiqgnltavfhllklvvpimrkqnfgriinygfqgadsapgwiyrsafaaakvglvslt ktvayeeaeygitanmvcpgdiigemkeatiqearqlkerktpigrsgtgediartisflceedsdmit gtiievtgavdvihrhr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.39 Rfree 0.248
    Matthews' coefficent 1.98 Rfactor 0.192
    Waters 60 Solvent Content 37.74

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3i4f

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch