.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hz6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of xylulokinase from Chromobacterium violaceum. To be Published
    Site NYSGXRC
    PDB Id 3hz6 Target Id NYSGXRC-11200b
    Related PDB Ids 3kzb 
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS28246,PF00370, 3.30.420.40, NP_901532.1 Molecular Weight 54391.05 Da.
    Residues 501 Isoelectric Point 5.63
    Sequence vafyiatfdigttevkaaladrdgglhfqrsialetygdgngpveqdagdwydavqriasswwqsgvda rrvsaivlsgqmqnflpldqdheplhravlysdkrplkeaeeinarhgadnlwsalenpmtaasilpkl vfwrasfpqafgrlrhvvlgakdyvvlrltgrhatdrtnasttglyrpkddawhvelladygfsldlmp rllepgeqvggvsalaarqtgfvsgtpvlcglgdagaatlgvgvlddedaylhlgttgwlarltqtdpv gdmpvgtifrlagiiagktlqvapvlnagnilqwaltlvghrpgedcaeyfhmaaaevqgvtvpdgllf vpylhaercpvelpaprgallgvtgattraqillavlegaalslrwcaellgmekvgllkvvgggarse awlrmiadnlnvsllvkpdahlhplrglaalaavelewshsiqdflreadlrepasnilhpqpcdegrr rrkferfkqcvetlgrld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.1927
    Matthews' coefficent 2.40 Rfactor 0.1625
    Waters 524 Solvent Content 48.71

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 1;PO4 (PHOSPHATE) x 1;GOL (GLYCEROL) x 2;MLI (MALONATE) x 1;XUL (D-XYLULOSE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3hz6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch