.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hu5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF isochorismatase family protein from Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough. To be Published
    Site NYSGXRC
    PDB Id 3hu5 Target Id NYSGXRC-11302d
    Molecular Characteristics
    Source Desulfovibrio vulgaris
    Alias Ids TPS28288,PF00857, 3.40.50.850, YP_009258.1 Molecular Weight 21418.51 Da.
    Residues 204 Isoelectric Point 5.38
    Sequence mtrnrtvalaiidmqndfvlpgapacvegamgtvpviagllakaraegwmvlhvvrahradgsdaeksr ehlfleggglcvagtpgaeivaglepasgetvlvktrfsafmgtecdmllrrrgvdtllvsgtqypnci rgtavdafaldydvvvvtdacsartpgvaesnindmramgitcvpltalddvlarrpvpsgppprc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.225
    Matthews' coefficent 2.23 Rfactor 0.187
    Waters 424 Solvent Content 44.78

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3hu5
    1. Crystal structure of a putative isochorismatase hydrolase from Oleispira antarctica
    AM Goral, KL Tkaczuk, M Chruszcz, O Kagan - Journal of Structural and , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch