.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hjg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative alpha-ribazole-5' -phosphate phosphatase FROM Vibrio parahaemolyticus. To be Published
    Site NYSGXRC
    PDB Id 3hjg Target Id NYSGXRC-11293d
    Molecular Characteristics
    Source Vibrio parahaemolyticus
    Alias Ids TPS28286,3.40.50.1240, NP_797686.1, PF00300 Molecular Weight 22853.78 Da.
    Residues 204 Isoelectric Point 5.23
    Sequence mktlniylmrhgkvdaapglhgqtdlkvkeaeqqqiamawktkgydvagiissplsrchdlaqilaeqq llpmtteddlqemdfgdfdgmpfdlltehwkkldafwqspahhslpnaeslstfsqrvsrawsqiindi ndnllivthggviriilahvlgvdwrnpqwystlaignasvthititiddqiyasvrsigvplved
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.28009
    Matthews' coefficent 6.20 Rfactor 0.26275
    Waters Solvent Content 80.17

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 3hjg

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch