.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hdv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of response regulator receiver protein from Pseudomonas putida. To be Published
    Site NYSGXRC
    PDB Id 3hdv Target Id NYSGXRC-11224l
    Molecular Characteristics
    Source Pseudomonas putida
    Alias Ids TPS28260,3.40.50.2300, PF00072, AAN65986.1 Molecular Weight 20648.77 Da.
    Residues 189 Isoelectric Point 5.04
    Sequence vvpigrksmsalvkdptkgetgyasnavlmlkrnffdemsmpehtdilsdaerealavinqsapvaarp lvlvvddnavnrealilylksrgidavgadgaeearlylhyqkriglmitdlrmqpesgldlirtiras eraalsiivvsgdtdveeavdvmhlgvvdfllkpvdlgkllelvnkelkig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.09 Rfree 0.245
    Matthews' coefficent 3.10 Rfactor 0.205
    Waters 243 Solvent Content 60.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3hdv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch