The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a thiol:disulfide interchange protein dsbA from Bordetella parapertussis. To be Published
    Site NYSGXRC
    PDB Id 3hd5 Target Id NYSGXRC-11213n
    Molecular Characteristics
    Source Bordetella parapertussis
    Alias Ids TPS28256,PF01323,, NP_886482.1 Molecular Weight 22815.91 Da.
    Residues 209 Isoelectric Point 6.90
    Sequence mqsttftrllaaaalaattlfapatqaqgaqqyvninppmpsdtpgkievleffaytcphcaaiepmve dwaktapqdvvlkqvpiafnagmkplqqlyytlqalerpdlhpkvftaihterkrlfdkkamgewaasq gvdrakfdsvfdsfsvqtqvqrasqlaeaahidgtpafavggrymtspvlagndyagalkvvdqlivqsrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.35 Rfree 0.265
    Matthews' coefficent 2.52 Rfactor 0.222
    Waters 163 Solvent Content 51.26

    Ligand Information


    Google Scholar output for 3hd5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch