.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hcw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Maltose Operon Transcriptional Repressor from Staphylococcus Aureus. To be Published
    Site NYSGXRC
    PDB Id 3hcw Target Id NYSGXRC-11226l
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS28262,3.40.50.2300, PF00532, BAB57670.1 Molecular Weight 38376.25 Da.
    Residues 339 Isoelectric Point 5.51
    Sequence mvtikdvalkagvspstvsrvikgnkriseatiskvkkvmeelnyfpntaartlitnqtykiglvlkgs eepirlnpfyinvllgisetcnqhgygtqttvsnnmndlmdevykmikqrmvdafillyskendpikqm lidesmpfivigkptsdidhqfthidndnilasenltrhvieqgvdelifitekgnfevskdriqgfet vasqfnldyqiietsnerevilnymqnlhtrlkdpnikqaiisldamlhlailsvlyelnieipkdvmt atfndsylteiasppqtcidikprmlgqqagsailnilknkaqdvielviidtelkirkstqr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.27184
    Matthews' coefficent 2.42 Rfactor 0.20841
    Waters 97 Solvent Content 46.96

    Ligand Information
    Ligands GOL (GLYCEROL) x 4
    Metals

    Jmol

     
    Google Scholar output for 3hcw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch