.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h9m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of para-aminobenzoate synthetase, component I from Cytophaga hutchinsonii. To be Published
    Site NYSGXRC
    PDB Id 3h9m Target Id NYSGXRC-11307k
    Molecular Characteristics
    Source Cytophaga hutchinsonii
    Alias Ids TPS27176,3.60.120.10, PF00425, YP_678417.1 Molecular Weight 48152.89 Da.
    Residues 429 Isoelectric Point 5.36
    Sequence msftplhttseafiekalpwledryfhiaylnpngytaypqgafrhylafgseaaihvsdatrvfetwn eikkgytnewifvfasydgknsveqlhtskeagiafaaatffipehvweiqpdgilihkgsgsslvtei qhaepstpvqqsdifvkqvvskesyfnafdelqqiiaqgdayeinycipftakgnispaatyqrlnkkt pmpfsvyykfnteyilsasperfikktgdtiisqpikgtskrgkskaedemlkqqlgtsekeqsentmi vdlvrndlsrtavagsvcvpelsglytfpnvhqlistvqstidpacssidviqqafpmgsmtgapkvnv mkfidriesmargpfsgtvgymdphdnfdfnvlirsifynsatqelfmeagsaitsyakaeteyeecll kitpmihilnnqqyy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.57 Rfree 0.192
    Matthews' coefficent 2.79 Rfactor 0.173
    Waters 406 Solvent Content 55.97

    Ligand Information
    Ligands DTU ((2R,3S)-1,4-DIMERCAPTOBUTANE-2,3-DIOL) x 1;PGE (TRIETHYLENE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3h9m

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch