.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h75

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Periplasmic Sugar-binding protein from the Pseudomonas fluorescens. To be Published
    Site NYSGXRC
    PDB Id 3h75 Target Id NYSGXRC-11233i
    Molecular Characteristics
    Source Pseudomonas fluorescens
    Alias Ids TPS27158,3.40.50.2300, PF00532, YP_260766.1 Molecular Weight 43507.61 Da.
    Residues 390 Isoelectric Point 8.98
    Sequence lsdnhdnlpplastlpvilpgrnsgallvmfkrlckwllclslpfwavahatsvvflnpgnstetfwvs ysqfmqaaardlgldlrilyaerdpqntlqqarelfqgrdkpdylmlvneqyvapqilrlsqgsgiklf ivnspltldqreligqsrqnysdwigsmvgddeeagyrmlkellhklgpvpaghgiellafsglkvtpa aqlrerglrralaehpqvhlrqlvygewnrerayrqaqqllkrypktqlvwsandemalgamqaarelg rkpgtdllfsgvnsspealqalidgklsvleaghftlggwalvalhddalgldarrlggpdwqlslfqa ltpaqarqllrlgdqvgtrvdfrglsaqgkpdsyrypfglqlllr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.230
    Matthews' coefficent 2.12 Rfactor 0.208
    Waters 282 Solvent Content 41.95

    Ligand Information
    Ligands SO4 (SULFATE) x 2;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3h75

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch