.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gyb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a LacI-family transcriptional regulatory protein from Corynebacterium glutamicum. To be Published
    Site NYSGXRC
    PDB Id 3gyb Target Id NYSGXRC-11232c
    Molecular Characteristics
    Source Corynebacterium glutamicum
    Alias Ids TPS27152,3.40.50.2300, NP_599422.1, PF00532 Molecular Weight 35416.07 Da.
    Residues 331 Isoelectric Point 5.34
    Sequence mstsrptiydvakaagvskslvslvlrgspnvskeseaavktaikklnyqpnraasdlaakrtqliavl iddysnpwfidliqslsdvltpkgyrlsvidsltsqagtdpitsalsmrpdgiiiaqdipdftvpdslp pfviagtritqasthdsvanddfrgaeiatkhlidlghthiahlrvgsgaglrrfesfeatmrahglep lsndylgpavehagytetlallkehpevtaifssnditaigalgaarelglrvpedlsiigydntplaq trlinlttiddnsigvgynaallllsmldpeaphpeimhtlqpsliergtcaprg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.231
    Matthews' coefficent 2.16 Rfactor 0.215
    Waters 297 Solvent Content 42.95

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3gyb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch