.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gwy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Ctp Pyrophosphohydrolase from Bacteroides fragilis. To be Published
    Site NYSGXRC
    PDB Id 3gwy Target Id NYSGXRC-11178l
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS27104,3.90.79.10, YP_212529.1 Molecular Weight 15120.66 Da.
    Residues 130 Isoelectric Point 5.37
    Sequence mksievvaavirlgekylcvqrgqtkfsytsfryefpggkveegeslqealqreimeemdyvievgekl ltvhhtypdfeitmhaflchpvgqryvlkehiaaqwlstremaildwaeadkpivrkiseq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.27092
    Matthews' coefficent 1.77 Rfactor 0.21641
    Waters 67 Solvent Content 30.42

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gwy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch