.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gv1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of disulfide interchange protein from Neisseria gonorrhoeae. To be Published
    Site NYSGXRC
    PDB Id 3gv1 Target Id NYSGXRC-11211h
    Molecular Characteristics
    Source Neisseria gonorrhoeae
    Alias Ids TPS27136,AAW90080.1, PF01323, 3.40.30.10 Molecular Weight 28704.54 Da.
    Residues 261 Isoelectric Point 8.49
    Sequence mktklikiltpftvlpllacgqtpvsnanaesavkaesagksvaaslkarlektysaqdlkvlsvsetp vkgiyevvvsgrqiiytdaeggymfvgelinidtrknlteeraadlnkidfaslpldkaikevrgngkl kvavfsdpdcpfckrlehefekmtdvtvysfmmpiaglhpdaarkaqilwcqpdrakawtdwmrkgkfp vggsicdnpvaettslgeqfgfngtptlvfpngrtqsgyspmpqleeiirknqq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.2280
    Matthews' coefficent 1.96 Rfactor 0.1797
    Waters 180 Solvent Content 37.08

    Ligand Information
    Ligands BEZ (BENZOIC) x 3
    Metals

    Jmol

     
    Google Scholar output for 3gv1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch