The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of LacI family transcription regulator from Agrobacterium tumefaciens. To be Published
    Site NYSGXRC
    PDB Id 3gv0 Target Id NYSGXRC-11224e
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS27144,, PF00532, AAK87313.2 Molecular Weight 37266.72 Da.
    Residues 339 Isoelectric Point 7.15
    Sequence mpsamggrptlktiaymtglgittvsralkdapdigaetkervrliarqigyqpnragvrlrtgktnvi alvlsvdeelmgftsqmvfgitevlsttqyhlvvtphihakdsmvpiryiletgsadgviiskiepndp rvrfmternmpfvthgrsdmgiehafhdfdneayayeaverlaqcgrkriavivppsrfsfhdharkgf nrgirdfgltefpidavtietplekirdfgqrlmqssdrpdgivsisgsstialvagfeaagvkigedv divskqsaeflnwikpqihtvnediklagrelakallaringeaaetlqsisgpvwssmapkp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.35 Rfree 0.25450
    Matthews' coefficent 3.72 Rfactor 0.19830
    Waters 88 Solvent Content 66.96

    Ligand Information


    Google Scholar output for 3gv0

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch