.
The Open Protein Structure Annotation Network
PDB Keyword
.

3guv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a resolvase family site-specific recombinase from Streptococcus pneumoniae. To be Published
    Site NYSGXRC
    PDB Id 3guv Target Id NYSGXRC-11223c
    Molecular Characteristics
    Source Streptococcus pneumoniae
    Alias Ids TPS27140,3.40.50.1390, YP_816399.1, PF00239 Molecular Weight 64483.64 Da.
    Residues 559 Isoelectric Point 8.56
    Sequence mskekikvylytrvstsiqiegysleaqksrmkafaiyndyeivgeyedagksgksiegriqfnrmmed iksgkdgvsfvlvfklsrfarnaadvlstlhimqdygvnlicvedgidsskdagklmisvlsavaeier eniriqtmegriqkaregkwnggfapygykledgklfineeeavairtifdqyvnttigangiskylen hgirkiprqngknplfdaglirkilknpvyngkiafgrrtlekvhgtrneykqveqdeylisegiheai vsdevwqaaqvklksqakkyehvnkgkdtrthllsgivkcpicgvgmfgnkcikkkkdgtkykdfyyyg cnhrqmirghkctfskqireellddavaevivkivsnpkfasmmqekinmkvdtseiekeidnyqkelr kshstkfklieeidnldvedkhykrrkqdlddrlyrmydkidelesslidakakkqtieaekltgdniy kvliyfdklykvmndverrqlisaliseiqvyeekqsngqwlksitfklpiieenlnidldndeqvecvsllekrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.291
    Matthews' coefficent 2.01 Rfactor 0.226
    Waters 30 Solvent Content 38.91

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3guv
    1. Protein topology from predicted residue contacts
    WR Taylor, DT Jones, MI Sadowski - Protein Science, 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch