.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gtz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative translation initiation inhibitor from Salmonella typhimurium. To be Published
    Site NYSGXRC
    PDB Id 3gtz Target Id NYSGXRC-13961b
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS26994,PF01042, AAV77022.1 Molecular Weight 12586.65 Da.
    Residues 114 Isoelectric Point 4.81
    Sequence msivridaedrwsdvviynntlwytgvpenldadafeqtantlaqidavlekqgssksrildatiflsd kadfaamnkawdawvvaghapvrctvqaglmnpkykveikivaav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.50 Rfree 0.260
    Matthews' coefficent 4.01 Rfactor 0.232
    Waters 15 Solvent Content 69.33

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3gtz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch