The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an N-acylglucosamine 2-epimerase family protein from Xylella fastidiosa. To be Published
    Site NYSGXRC
    PDB Id 3gt5 Target Id NYSGXRC-11262a
    Molecular Characteristics
    Source Xylella fastidiosa
    Alias Ids TPS27172,, PF07221, AAO29015.1 Molecular Weight 46923.17 Da.
    Residues 401 Isoelectric Point 5.67
    Sequence mtplpatpvpdfrsadflrthisdtmafyhprcidsaggffhyfrddgsiynathrhlvsstrfvfnya maylqfgtaeyldavhhglsyvrdvhrnpatggyawtlcddrveddtnhcyglafvmlayscglkvgik qarewmdetwcllerhfwdaeyglykdeadaqwnftryrgqnanmhmceamlaayeasgeqryleralv ladritrrqaakadglvwehydmrwevdwdynrdnpkhlfrpwgfqpghqtewaklllildryievewl vpvarslfdvavarswdavrgglcygfapdgticdddkyfwvqaeslaaaallatrsgderywqwydrl wayawqhmvdhrygawyrlldgdnrkyndekspagktdyhtmgachevlnvvwtks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.221
    Matthews' coefficent 2.21 Rfactor 0.183
    Waters 274 Solvent Content 44.44

    Ligand Information
    Metals CL (CHLORIDE) x 1


    Google Scholar output for 3gt5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch