The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF RIBOSOMAL PROTEIN 11 METHYLASE FROM Lactobacillus delbrueckii subsp. bulgaricus. To be Published
    Site NYSGXRC
    PDB Id 3grz Target Id NYSGXRC-11124p
    Molecular Characteristics
    Source Lactobacillus delbrueckii subsp. bulgaricus
    Alias Ids TPS27055,YP_812853.1, Molecular Weight 34928.60 Da.
    Residues 314 Isoelectric Point 4.44
    Sequence mklleikiessydvedalayfatedlkalgtearrrsdfeqagwlhdstvvdmddipnlpdelefiayf deetdpeemvkcfkdklaelagyglktapgeisvdyvadqdwntvwkkyyhvinlsrhlaivpewedyq pvfkdqeiirldpglafgtgnhqttqlamlgieramvkpltvadvgtgsgilaiaahklgaksvlatdi sdesmtaaeenaalngiydialqktslladvdgkfdlivanilaeilldlipqldshlnedgqvifsgi dylqlpkieqalaensfqidlkmragrwiglaisrkhd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.22461
    Matthews' coefficent 2.50 Rfactor 0.17356
    Waters 233 Solvent Content 50.84

    Ligand Information
    Ligands GOL (GLYCEROL) x 3


    Google Scholar output for 3grz

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch