.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gra

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of AraC family transcriptional regulator from Pseudomonas putida. To be Published
    Site NYSGXRC
    PDB Id 3gra Target Id NYSGXRC-11171e
    Molecular Characteristics
    Source Pseudomonas putida
    Alias Ids TPS27096,AAN69127.1, 3.40.50.880 Molecular Weight 37043.28 Da.
    Residues 335 Isoelectric Point 7.78
    Sequence vptprqfsqktstsnmlrlktsganaqapyrvdfillehfsmasftvamdvlvtanllradsfqftpls ldgdrvlsdlglelvatelsaaalkeldllvvcgglrtplkypeldrllndcaahgmalgglwngawfl gragvlddygcsihpeqraslserspqtritpasftldrdrlsaaspngamelmlglvrrlygdglaeg veeilsfsgaryrqvgpgakksmslhlrtivelmennleetlsldqlaaysgrsrrqidrlfqaqlgts prryymelritksrrllqysdlsvmevavacgfvsvshfskcyaayfgyppsreqrlge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.288
    Matthews' coefficent 2.10 Rfactor 0.268
    Waters 78 Solvent Content 41.40

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 2;SO4 (SULFATE) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3gra

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch