.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gpk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of PpiC-type peptidyl-prolyl cis-trans isomerase domain at 1.55A resolution. To be Published
    Site NYSGXRC
    PDB Id 3gpk Target Id NYSGXRC-11189o
    Molecular Characteristics
    Source Novosphingobium aromaticivorans
    Alias Ids TPS27116,PF00639, 3.10.50.40, YP_496167.1 Molecular Weight 49038.76 Da.
    Residues 456 Isoelectric Point 5.24
    Sequence mtsklnisrkaaisafgrslgttamalaafatatspvlaqganaplnipanpqmfgtndpnvrrataiv ngeiitgtdveqrlalivsanggkidgeekerlrmqvlrnlidetlqiqeakaadvpaddgqvdasyer vatqnfgqsadalekylarigssaaslkrqirgeiawqnllrrnvqpfvnvsegevqeamqrlqaskgt eeyrigeiflaateenkpqvfanaekiveqlkqggsfvayarqyseastaavggdlgwirlaqlptela ttaasmgpgqlagpveirggfsilylidkrqvltadprdallslkqisiefpkgatneiatkraaefaa avkaikgcgdaeaqankigatvvandqikardlpgalqetllnlpigqttppfgsieegvrvlmlcgrd dpqvnsgpsfdemmaqieddrvnkraqtylrdlrrdavieyn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.55 Rfree 0.232
    Matthews' coefficent 2.06 Rfactor 0.201
    Waters 237 Solvent Content 40.27

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3gpk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch