.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gms

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative NADPH:quinone reductase from Bacillus thuringiensis. To be published
    Site NYSGXRC
    PDB Id 3gms Target Id NYSGXRC-11165b
    Molecular Characteristics
    Source Bacillus thuringiensis
    Alias Ids TPS27094,3.40.50.720, YP_893774.1 Molecular Weight 36572.19 Da.
    Residues 330 Isoelectric Point 6.87
    Sequence lhgkliqfqkfgnpkdvlqveyknieplkdnevlvrmlvrpinpsdlipitgayahriplpnipgyegv givedvgagvtsdligkrvlplrgegtwqeyvktsadfvvpipdsiddftaaqmyinpltawvtctetl nlqrndvllvnacgsaighlfaqlsqilnfrliavtrnnkhteellrlgaayvidtstaplyetvmtlt nglgadaaidsiggpdgnalafslrpnghfltigllsgvqvnwaeivtkakvhanifhlrhwnkdvppy kwqetfrhlirlvenkqlrfmkvhstydladvkaavdvvqsaektkgkvfltsy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.76 Rfree 0.234
    Matthews' coefficent 2.65 Rfactor 0.199
    Waters 147 Solvent Content 53.59

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gms

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch