.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gmf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein-disulfide isomerase from Novosphingobium aromaticivorans. To be Published
    Site NYSGXRC
    PDB Id 3gmf Target Id NYSGXRC-11216o
    Molecular Characteristics
    Source Novosphingobium aromaticivorans
    Alias Ids TPS27138,PF01323, 3.40.30.10, YP_496237.1 Molecular Weight 25935.39 Da.
    Residues 238 Isoelectric Point 9.38
    Sequence migksiraiagtmiaagaavllmgagkpakpapranwvasstvtadghhllgnpaaklrlvefvsytcp hcshfeiesegqlkigmvqpgkgaievrnfvrdpidmtvalitncvppsrfftlhtafmrsqaqwigpl ansteaqrqrwfngtfatrtraiasdfrfydfmaargmdrstldrclsnealakklaaetdeainqynv sgtpsfmidgillagthdwaslrpqilarln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.76 Rfree 0.22908
    Matthews' coefficent 2.52 Rfactor 0.18456
    Waters 182 Solvent Content 51.13

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 3gmf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch