.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gl3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative Thiol:disulfide interchange protein DsbE from Chlorobium tepidum. To be Published
    Site NYSGXRC
    PDB Id 3gl3 Target Id NYSGXRC-11210h
    Molecular Characteristics
    Source Chlorobium tepidum
    Alias Ids TPS27134,PF08534, 3.40.30.10, AAM72305.1 Molecular Weight 18392.43 Da.
    Residues 170 Isoelectric Point 9.54
    Sequence mkrstlstcrvalfalvlsvglsanahaldkgdkapdfalpgktgvvklsdktgsvvyldfwaswcgpc rqsfpwmnqmqakykakgfqvvavnldaktgdamkflaqvpaeftvafdpkgqtprlygvkgmptsfli drngkvllqhvgfrpadkealeqqilaalggn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.09 Rfree 0.296
    Matthews' coefficent 1.99 Rfactor 0.263
    Waters 201 Solvent Content 38.15

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gl3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch