The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative enoyl-CoA hydratase from Streptomyces avermitilis. To be Published
    Site NYSGXRC
    PDB Id 3gkb Target Id NYSGXRC-11252b
    Molecular Characteristics
    Source Streptomyces avermitilis
    Alias Ids TPS27166,, PF00378, NP_821667.1 Molecular Weight 29293.52 Da.
    Residues 277 Isoelectric Point 4.76
    Sequence mrndaystlrvssehgvariildnppvnvigatmmrelrtvlttladdssvrvivfssadpefflahvd mrigekmdalqelaasapadvnvfqavgelirhqpqvtivklagkargggaefvaaadmafaaaetagl gqiealmgiipggggtqylrgrvgrnralevvltadlfdaetaasygwinralpadeldeyvdrvarni aalpdgvieaakrslpaddlkegllgendawaatfslpaaqqlisgglkdgaqtpagerdleglmrsvar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.80 Rfree 0.206
    Matthews' coefficent 2.16 Rfactor 0.171
    Waters 684 Solvent Content 42.95

    Ligand Information
    Ligands GOL (GLYCEROL) x 3


    Google Scholar output for 3gkb

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch