.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gh1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of predicted nucleotide-binding protein from Vibrio cholerae.
    Site NYSGXRC
    PDB Id 3gh1 Target Id NYSGXRC-10419a
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS27184,BIG_812, Y619_METJA Molecular Weight 57478.74 Da.
    Residues 506 Isoelectric Point 6.24
    Sequence mekktlslcpiclkripatileedgkiiikktcpehgefkdiywgdaelykkfdkyefigkievtntkvk ngcpydcglcpnhksttilanidvtnrcnlncpicfananksgkvyepsfedikrmmenlrkeipptpa iqfaggeptvrsdlpeliklardmgflhvqlatngiklkninylkklkeaglstiylqfdgisekpylv argknllpikqkvienckkvgfdsvvlvptlvrgvndnevggiiryaaenvdvvrginfqpvsftgrvd ektllegritipdfiklveeqtdgeiteedfypvpsvapisvlvekltndrkptlsshqhcgtstyvfv dedgklipitrfidvegfleivkekieeigkskmhdvkvlgeialklpslidldkapksvnikkiidli lsvlksdysalaelhyhmlmiscmhfmdaynfdvkrvmrccihyatpddriipfctyntlhrqeveekf sipleewkrmhkiggeddredy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.226
    Matthews' coefficent 2.38 Rfactor 0.169
    Waters 1329 Solvent Content 48.21

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 3gh1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch